| Name | PAM, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5303458 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | PAM antibody was raised using the N terminal of PAM corresponding to a region with amino acids PKGVGFRVGGETGSKYFVLQVHYGDISAFRDNNKDCSGVSLHLTRLPQPL |
| Purity/Format | Affinity purified |
| Description | PAM antibody |
| Gene | MYCBP2 |
| Supplier Page | Shop |