PIGZ, Polyclonal Antibody

Name PIGZ, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS5301209
Prices $455.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen PIGZ antibody was raised using the N terminal of PIGZ corresponding to a region with amino acids VLWGGLSLLRVLWCLLPQTGYVHPDEFFQSPEVMAEDILGVQAARPWEFY
Purity/Format Affinity purified
Description PIGZ antibody
Gene PIGZ
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.