| Name | PIGZ, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5301209 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | PIGZ antibody was raised using the N terminal of PIGZ corresponding to a region with amino acids VLWGGLSLLRVLWCLLPQTGYVHPDEFFQSPEVMAEDILGVQAARPWEFY |
| Purity/Format | Affinity purified |
| Description | PIGZ antibody |
| Gene | PIGZ |
| Supplier Page | Shop |