SPPL2B, Polyclonal Antibody

Name SPPL2B, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS839114
Prices $455.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB IHC
Species Reactivities Human
Antigen SPPL2B antibody was raised using the N terminal of SPPL2B corresponding to a region with amino acids VARGNCTFYEKVRLAQGSGARGLLIVSRERLVPPGGNKTQYDEIGIPVAL
Purity/Format Affinity purified
Description SPPL2B antibody
Gene SPPL2B
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.