Name | SPPL2B, Polyclonal Antibody |
---|---|
Supplier | MyBioSource |
Catalog | MBS839114 |
Prices | $455.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB IHC |
Species Reactivities | Human |
Antigen | SPPL2B antibody was raised using the N terminal of SPPL2B corresponding to a region with amino acids VARGNCTFYEKVRLAQGSGARGLLIVSRERLVPPGGNKTQYDEIGIPVAL |
Purity/Format | Affinity purified |
Description | SPPL2B antibody |
Gene | SPPL2B |
Supplier Page | Shop |