Name | TMEM30A, Polyclonal Antibody |
---|---|
Supplier | MyBioSource |
Catalog | MBS5300614 |
Prices | $490.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB IHC |
Species Reactivities | Human, Mouse, Rat, Dog, Zebrafish |
Antigen | TMEM30A antibody was raised using the N terminal of TMEM30A corresponding to a region with amino acids FTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKEC |
Purity/Format | Affinity purified |
Description | TMEM30A antibody |
Gene | TMEM30A |
Supplier Page | Shop |