CC2D2A antibody
| Name | CC2D2A antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA338019 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Guinea Pig, Human, Mouse |
| Antigen | The immunogen for anti-CC2D2A antibody is: synthetic peptide directed towards the N-terminal region of Human CC2D2A. Synthetic peptide located within the following region: EDADMGRQNKNSKVRRQPRKKQKPTPFSRACWQILPHLSAGVPLLGWEHP. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | CC2D2A |
| Supplier Page | Shop |
Product images
WB Suggested Anti-CC2D2A Antibody; Titration: 1.0 ug/ml; Positive Control: MDA-MB-435S Whole Cell