CDC42SE2 antibody
| Name | CDC42SE2 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331833 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for Anti-CDC42SE2 Antibody is: synthetic peptide directed towards the middle region of Human CDC42SE2. Synthetic peptide located within the following region: NFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKA. |
| Description | Rabbit Polyclonal |
| Gene | CDC42SE2 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: CDC42SE2; Sample Tissue: COLO205 Whole Cell lysates; Antibody Dilution: 1.0ug/ml