CKAP1 / TBCB antibody

Name CKAP1 / TBCB antibody
Supplier Acris Antibodies
Catalog TA340003
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat
Antigen The immunogen for anti-Tbcb antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FKCKLELVVGSPASCMELELYGADDKFYSKLDQEDALLGSYPVDDGCRIH.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene Tbcb
Supplier Page Shop

Product images