Cytokeratin 74 antibody

Name Cytokeratin 74 antibody
Supplier Acris Antibodies
Catalog TA331333
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Sheep
Antigen The immunogen for Anti-KRT74 antibody is: synthetic peptide directed towards the N-terminal region of Human KRT74. Synthetic peptide located within the following region: VCPPGGIHQVTVNKSLLAPLNVELDPEIQKVRAQEREQIKVLNDKFASFI.
Description Rabbit Polyclonal
Gene KRT74
Supplier Page Shop

Product images