DERA antibody
| Name | DERA antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA343318 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat |
| Antigen | The immunogen for anti-DERA antibody is: synthetic peptide directed towards the N-terminal region of Human DERA. Synthetic peptide located within the following region: KKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKALN. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | DERA |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: DERA; Sample Tissue: THP-1 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml