FAM116A antibody
| Name | FAM116A antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA337641 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for anti-DENND6A antibody: synthetic peptide directed towards the middle region of human DENND6A. Synthetic peptide located within the following region: KPGVYTSYKPYLNRDEEIIKQLQKGVQQKRPSEAQSVILRRYFLELTQSF. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | DENND6A |
| Supplier Page | Shop |
Product images
WB Suggested Anti-DENND6A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: 293T cell lysate