G6PC3 antibody
| Name | G6PC3 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA337919 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish |
| Antigen | The immunogen for anti-G6PC3 antibody is: synthetic peptide directed towards the N-terminal region of Human G6PC3. Synthetic peptide located within the following region: ESGYYSQAPAQVHQFPSSCETGPGSPSGHCMITGAALWPIMTALSSQVAT. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | G6PC3 |
| Supplier Page | Shop |
Product images
Host:Rabbit; Target Name:G6PC3; Sample Tissue:Human Fetal Lung; Antibody Dilution: 1.0 ug/ml