HGSNAT antibody
| Name | HGSNAT antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA337878 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat |
| Antigen | The immunogen for anti-HGSNAT antibody is: synthetic peptide directed towards the C-terminal region of Human HGSNAT. Synthetic peptide located within the following region: VKGLWTGTPFFYPGMNSILVYVGHEVFENYFPFQWKLKDNQSHKEHLTQN. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | HGSNAT |
| Supplier Page | Shop |
Product images
WB Suggested Anti-HGSNAT Antibody; Titration: 1.0 ug/ml; Positive Control: OVCAR-3 Whole Cell HGSNAT is supported by BioGPS gene expression data to be expressed in OVCAR3