HGSNAT antibody
| Name | HGSNAT antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA337879 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Horse, Human |
| Antigen | The immunogen for anti-HGSNAT antibody is: synthetic peptide directed towards the N-terminal region of Human HGSNAT. Synthetic peptide located within the following region: RALAALLLAASVLSAALLAPGGSSGRDAQAAPPRDLDKKRHAELKMDQAL. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | HGSNAT |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: HGSNAT; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml HGSNAT is supported by BioGPS gene expression data to be expressed in HepG2