Josephin-1 / JOSD1 antibody
| Name | Josephin-1 / JOSD1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA337366 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rat |
| Antigen | The immunogen for Anti-JOSD1 antibody is: synthetic peptide directed towards the N-terminal region of Human JOSD1. Synthetic peptide located within the following region: SCVPWKGDKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAF. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | JOSD1 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: JOSD1; Sample Tissue: MCF7 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml