KNSTRN antibody
| Name | KNSTRN antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA333585 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for Anti-C15orf23 Antibody is: synthetic peptide directed towards the N-terminal region of Human C15orf23. Synthetic peptide located within the following region: YRKFLFETQAADLAGGTTVAAGNLLNESEKDCGQDRRAPGVQPCRLVTMT. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | KNSTRN |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: C15orf23; Sample Tissue: MDA-MB-435S Whole Cell lysates; Antibody Dilution: 1.0 ug/ml.