MAP6 antibody
| Name | MAP6 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA342905 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat |
| Antigen | The immunogen for anti-MAP6 antibody is: synthetic peptide directed towards the middle region of Human MAP6. Synthetic peptide located within the following region: IRSLYSEPFKEPPKVEKPSVQSSKPKKTSASHKPTRKAKDKQAVSGQAAK. |
| Description | Rabbit Polyclonal |
| Gene | MAP6 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: MAP6; Sample Tissue: Placenta lysates; Antibody Dilution: 1.0 ug/ml