MEF2B antibody
| Name | MEF2B antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA341792 |
| Prices | $325.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse, Rat |
| Antigen | The immunogen for anti-MEF2B antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PVARSLCKEGPPSRGASPPTPPVSIKSERLSPVTGTSGDFPRSFPYPLLL. |
| Description | Rabbit Polyclonal |
| Gene | Mef2b |
| Supplier Page | Shop |
Product images
WB Suggested Anti-MEF2B Antibody Titration: 0.625 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Lymphnode