MEF2B antibody

Name MEF2B antibody
Supplier Acris Antibodies
Catalog TA341792
Prices $325.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Mouse, Rat
Antigen The immunogen for anti-MEF2B antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PVARSLCKEGPPSRGASPPTPPVSIKSERLSPVTGTSGDFPRSFPYPLLL.
Description Rabbit Polyclonal
Gene Mef2b
Supplier Page Shop

Product images