METTL14 antibody
| Name | METTL14 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA339744 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for anti-KIAA1627 antibody: synthetic peptide directed towards the N terminal of human KIAA1627. Synthetic peptide located within the following region: LNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDEL. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | METTL14 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-METTL14 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: NCI-H226 cell lysate