NEURL1B antibody
| Name | NEURL1B antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA330881 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat |
| Antigen | The immunogen for Anti-NEURL1B antibody is: synthetic peptide directed towards the C-terminal region of Human NEURL1B. Synthetic peptide located within the following region: GQLRLLGTLQSSPATTTPSGSLSGSQDDSDSDMTFSVNQSSSASESSLVT. |
| Description | Rabbit Polyclonal |
| Gene | NEURL1B |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: NEURL1B; Sample Tissue: MCF7 Whole Cell lysates; Antibody Dilution: 1.0ug/ml