NOLA3 antibody
| Name | NOLA3 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA344845 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for anti-NOLA3 antibody: synthetic peptide directed towards the middle region of human NOLA3. Synthetic peptide located within the following region: MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKK. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | NOP10 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-NOLA3 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysateNOP10 is supported by BioGPS gene expression data to be expressed in Jurkat