PIGZ antibody

Name PIGZ antibody
Supplier Acris Antibodies
Catalog TA343937
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast
Antigen The immunogen for anti-PIGZ antibody: synthetic peptide directed towards the N terminal of human PIGZ. Synthetic peptide located within the following region: VLWGGLSLLRVLWCLLPQTGYVHPDEFFQSPEVMAEDILGVQAARPWEFY.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene PIGZ
Supplier Page Shop

Product images