PKD1L1 antibody
| Name | PKD1L1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA337921 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for anti-PKD1L1 antibody is: synthetic peptide directed towards the N-terminal region of Human PKD1L1. Synthetic peptide located within the following region: MSDGKCGCPWCALNGKAEDRESQSPSSSASRQKNIWKTTSEAALSVVNEK. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | PKD1L1 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-PKD1L1 Antibody; Titration: 1.0 ug/ml; Positive Control: NCI-H226 Whole Cell