PREX2 / DEPDC2 antibody

Name PREX2 / DEPDC2 antibody
Supplier Acris Antibodies
Catalog TA331729
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Antigen The immunogen for Anti-PREX2 Antibody is: synthetic peptide directed towards the N-terminal region of Human PREX2. Synthetic peptide located within the following region: ERDYVGTLEFLVSAFLHRMNQCAASKVDKNVTEETVKMLFSNIEDILAVH.
Description Rabbit Polyclonal
Gene PREX2
Supplier Page Shop

Product images