Name | PTPLAD2 antibody |
---|---|
Supplier | Acris Antibodies |
Catalog | TA336126 |
Prices | $325.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Bovine, Dog, Horse, Human, Pig, Rabbit, Rat |
Antigen | The immunogen for Anti-PTPLAD2 Antibody: synthetic peptide directed towards the middle region of human PTPLAD2. Synthetic peptide located within the following region: LLHIYVGIESNHLLPRFLQLTERIIILFVVITSQEEVQEKYVVCVLFVFW. |
Purity/Format | Affinity Purified |
Description | Rabbit Polyclonal |
Gene | HACD4 |
Supplier Page | Shop |