SLC4A5 / NBC4 antibody
| Name | SLC4A5 / NBC4 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA333726 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for Anti-SLC4A5 Antibody: synthetic peptide directed towards the middle region of human SLC4A5. Synthetic peptide located within the following region: SIAHIDSLKMETETSAPGEQPQFLGVREQRVTGIIVFILTGISVFLAPIL. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | SLC4A5 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-SLC4A5 Antibody Titration: 0.2-1 ug/ml; Positive Control: THP-1 cell lysate