SMCR7 antibody
| Name | SMCR7 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331633 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Horse, Guinea Pig, Human, Rat |
| Antigen | The immunogen for Anti-SMCR7 Antibody is: synthetic peptide directed towards the N-terminal region of Human SMCR7. Synthetic peptide located within the following region: FSQKRGKRRSDEGLGSMVDFLLANARLVLGVGGAAVLGIATLAVKRFIDR. |
| Description | Rabbit Polyclonal |
| Gene | MIEF2 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: SMCR7; Sample Tissue: HT1080 Whole Cell lysates; Antibody Dilution: 1.0ug/ml