SPPL2B antibody
| Name | SPPL2B antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA335943 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Bovine, Dog, Horse, Human, Mouse, Pig, Rat |
| Antigen | The immunogen for Anti-SPPL2B Antibody: synthetic peptide directed towards the N terminal of human SPPL2B. Synthetic peptide located within the following region: VARGNCTFYEKVRLAQGSGARGLLIVSRERLVPPGGNKTQYDEIGIPVAL. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | SPPL2B |
| Supplier Page | Shop |
Product images
WB Suggested Anti-SPPL2B Antibody Titration: 1 ug/ml; Positive Control: Jurkat cell lysate;SPPL2B is supported by BioGPS gene expression data to be expressed in Jurkat