TMEM30A / CDC50A antibody
| Name | TMEM30A / CDC50A antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA342365 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rat, Zebrafish |
| Antigen | The immunogen for anti-TMEM30A antibody is: synthetic peptide directed towards the middle region of Human TMEM30A. Synthetic peptide located within the following region: FTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKEC. |
| Description | Rabbit Polyclonal |
| Gene | TMEM30A |
| Supplier Page | Shop |
Product images
WB Suggested Anti-TMEM30A Antibody Titration: 1 ug/ml; Positive Control: HepG2 cell lysate