Name | TMEM30A / CDC50A antibody |
---|---|
Supplier | Acris Antibodies |
Catalog | TA342365 |
Prices | $325.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | IHC-P WB |
Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rat, Zebrafish |
Antigen | The immunogen for anti-TMEM30A antibody is: synthetic peptide directed towards the middle region of Human TMEM30A. Synthetic peptide located within the following region: FTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKEC. |
Description | Rabbit Polyclonal |
Gene | TMEM30A |
Supplier Page | Shop |