UGT1A5 antibody
| Name | UGT1A5 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331083 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | The immunogen for anti-UGT1A5 antibody: synthetic peptide directed towards the N terminal of human UGT1A5. Synthetic peptide located within the following region: EENFFTLTTYAISWTQDEFDRLLLGHTQSFFETEHLLMKFSRRMAIMNNM. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | UGT1A5 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-UGT1A5 Antibody Titration: 0.2-1 ug/ml; Positive Control: HT1080 cell lysate