UGT1A7 antibody
| Name | UGT1A7 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331082 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Human |
| Antigen | The immunogen for anti-UGT1A7 antibody: synthetic peptide directed towards the N terminal of human UGT1A7. Synthetic peptide located within the following region: VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSN. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | UGT1A7 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-UGT1A7 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:2500; Positive Control: 721_B cell lysate; There is BioGPS gene expression data showing that UGT1A7 is expressed in 721_B