USP9Y antibody
| Name | USP9Y antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA342578 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat |
| Antigen | The immunogen for anti-USP9Y antibody: synthetic peptide directed towards the C terminal of human USP9Y. Synthetic peptide located within the following region: PHSPASQYQQNNHVHGQPYTGPAAHHLNNPQKTGQRTQENYEGNEEVSSP. |
| Description | Rabbit Polyclonal |
| Gene | USP9Y |
| Supplier Page | Shop |
Product images
WB Suggested Anti-USP9Y Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human Muscle