WHAMM antibody
| Name | WHAMM antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331240 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Horse, Human, Pig, Rat |
| Antigen | The immunogen for Anti-WHAMM antibody is: synthetic peptide directed towards the C-terminal region of Human WHAMM. Synthetic peptide located within the following region: SEAGNVKSPKCQNCHGNIPVQVFVPVGDQTHSKSSEELSLPPPPPPPPPP. |
| Description | Rabbit Polyclonal |
| Gene | WHAMM |
| Supplier Page | Shop |
Product images
WB Suggested Anti-WHAMM Antibody; Titration: 1.0 ug/ml; Positive Control: Placenta