ZNF406 antibody
| Name | ZNF406 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA332158 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Human, Mouse |
| Antigen | The immunogen for Anti-ZFAT1 Antibody: synthetic peptide directed towards the middle region of human ZFAT1. Synthetic peptide located within the following region: KHIRDAHDPQDKKVKEALDELCLMTREGKRQLLYDCHICERKFKNELDRD. |
| Description | Rabbit Polyclonal |
| Gene | ZFAT |
| Supplier Page | Shop |
Product images
WB Suggested Anti-ZFAT1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Muscle