Name | ZNF406 antibody |
---|---|
Supplier | Acris Antibodies |
Catalog | TA332158 |
Prices | $325.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Dog, Human, Mouse |
Antigen | The immunogen for Anti-ZFAT1 Antibody: synthetic peptide directed towards the middle region of human ZFAT1. Synthetic peptide located within the following region: KHIRDAHDPQDKKVKEALDELCLMTREGKRQLLYDCHICERKFKNELDRD. |
Description | Rabbit Polyclonal |
Gene | ZFAT |
Supplier Page | Shop |