RGS7BP antibody
| Name | RGS7BP antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA334912 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Pig, Rat |
| Antigen | The immunogen for anti-RGS7BP antibody is: synthetic peptide directed towards the middle region of Human RGS7BP. Synthetic peptide located within the following region: RLYIQLQCCLEMYTTEMLKSICLLGSLQFHRKGKEPGGGTKSLDCKIEES. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | RGS7BP |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: RGS7BP; Sample Tissue: MCF7 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml