SPC25 Antibody
| Name | SPC25 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-47263 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: RLGLEIRKIYGEKLQFIFTNIDPKNPESPFMFSLHLNEARDYEVSDSAPHLEGLAEFQENVRKTNNFSAFLANVRKAFTATVY |
| Purity/Format | Affinity purified |
| Blocking Peptide | SPC25 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SPC25 |
| Supplier Page | Shop |
Product images
![Western Blot: SPC25 Antibody [NBP2-47263] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/19792_SPC25%2520Antibody-Western%2520Blot-NBP2-47263-img0003.jpg)
Western Blot: SPC25 Antibody [NBP2-47263] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG.
![Immunohistochemistry: SPC25 Antibody [NBP2-47263] - Analysis of human lymph node shows strong cytoplasmic positivity in germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/19793_SPC25-Antibody-Immunohistochemistry-NBP2-47263-img0002.jpg)
Immunohistochemistry: SPC25 Antibody [NBP2-47263] - Analysis of human lymph node shows strong cytoplasmic positivity in germinal center cells.
![Immunofluorescence: SPC25 Antibody [NBP2-47263] - Analysis of human cell line U-2 OS shows positivity in cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/19794_SPC25-Antibody-Immunofluorescence-NBP2-47263-img0001.jpg)
Immunofluorescence: SPC25 Antibody [NBP2-47263] - Analysis of human cell line U-2 OS shows positivity in cytoplasm.