CLK2 Antibody

Name CLK2 Antibody
Supplier Novus Biologicals
Catalog NBP2-47506
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against a recombinant protein corresponding to amino acids: HPRRYHSSERGSRGSYREHYRSRKHKRRRSRSWSSSSDRTRRRRREDSYHVRSRSSYDDRSSDR
Purity/Format Immunogen affinity purified
Blocking Peptide CLK2 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene TELO2
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.