STEAP3/TSAP6 Antibody
| Name | STEAP3/TSAP6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13395 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: PKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKI LVDVSNPTEQEHLQHRE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | STEAP3/TSAP6 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | STEAP3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: STEAP3/TSAP6 Antibody [NBP2-13395] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: U-251 MG](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15220_STEAP3-TSAP6-Antibody-Western-Blot-NBP2-13395-img0002.jpg)
Western Blot: STEAP3/TSAP6 Antibody [NBP2-13395] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: U-251 MG
![Immunocytochemistry/Immunofluorescence: STEAP3/TSAP6 Antibody [NBP2-13395] - Staining of human cell line U-2 OS shows localization to nucleoli & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15221_STEAP3-TSAP6-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13395-img0003.jpg)
Immunocytochemistry/Immunofluorescence: STEAP3/TSAP6 Antibody [NBP2-13395] - Staining of human cell line U-2 OS shows localization to nucleoli & cytosol.
![Immunohistochemistry-Paraffin: STEAP3/TSAP6 Antibody [NBP2-13395] - Staining of human liver shows strong cytoplasmic and membranous positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15222_STEAP3-TSAP6-Antibody-Immunohistochemistry-Paraffin-NBP2-13395-img0001.jpg)
Immunohistochemistry-Paraffin: STEAP3/TSAP6 Antibody [NBP2-13395] - Staining of human liver shows strong cytoplasmic and membranous positivity in hepatocytes.