Coronin-1a Antibody
| Name | Coronin-1a Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13861 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: RELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRL DRLEETVQA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Coronin-1a Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CORO1A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Coronin-1a Antibody [NBP2-13861] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11955_Coronin-1a-Antibody-Western-Blot-NBP2-13861-img0002.jpg)
Western Blot: Coronin-1a Antibody [NBP2-13861] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
![Immunohistochemistry-Paraffin: Coronin-1a Antibody [NBP2-13861] - Staining of human tonsil shows cytoplasmic positivity in germinal center cells and non-germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11956_Coronin-1a-Antibody-Immunohistochemistry-Paraffin-NBP2-13861-img0003.jpg)
Immunohistochemistry-Paraffin: Coronin-1a Antibody [NBP2-13861] - Staining of human tonsil shows cytoplasmic positivity in germinal center cells and non-germinal center cells.