ASAH2/N-acylsphingosine Amidohydrolase-2 Antibody

Name ASAH2/N-acylsphingosine Amidohydrolase-2 Antibody
Supplier Novus Biologicals
Catalog NBP2-49326
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against a recombinant protein corresponding to amino acids:RTFGDVLQPAKPEYRVGEVAEVIFVGANPKNSVQNQNHQT
Purity/Format Immunogen affinity purified
Blocking Peptide ASAH2/N-acylsphingosine Amidohydrolase-2 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene ASAH2
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.