SMG1 Antibody
| Name | SMG1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-88913 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PGSRLSSGGTNYSRSWNDWQPRTDSASADPGNLKYSSSRDRGGSSSYGLQPSNSAVVSRQRHDDTRVHADIQNDEKGGYSVN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SMG1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SMG1 |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: SMG1 Antibody [NBP1-88913] - Staining of human cell line U-2 OS shows positivity in cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/21888_SMG1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88913-img0003.jpg)
![Immunohistochemistry-Paraffin: SMG1 Antibody [NBP1-88913] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/21889_SMG1%2520Antibody-Immunohistochemistry-Paraffin-NBP1-88913-img0002.jpg)