ZFPM1 Antibody
| Name | ZFPM1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-47572 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: GFISTTRDILYSHLVTNHMVCQPGSKGEIYSPGAGHPATKLPPDSLGSFQQQHTALQGPLASADLGLAPTPSPGLDRKALAEATNGEARAAPQNGGSS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ZFPM1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ZFPM1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: ZFPM1 Antibody [NBP2-47572] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleoplasm, cytosol & vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6138_ZFPM1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-47572-img0003.jpg)
Immunocytochemistry/Immunofluorescence: ZFPM1 Antibody [NBP2-47572] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleoplasm, cytosol & vesicles.
![Immunohistochemistry: ZFPM1 Antibody [NBP2-47572] - Staining of human stomach shows strong nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6139_ZFPM1-Antibody-Immunohistochemistry-NBP2-47572-img0002.jpg)
Immunohistochemistry: ZFPM1 Antibody [NBP2-47572] - Staining of human stomach shows strong nuclear positivity in glandular cells.