BARD1 Antibody
| Name | BARD1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-47543 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: MIQLCSKLRNLLHDNELSDLKEDKPRKSLFNDAGNKKNSIKMWFSPRSKKVRYVVSKASVQTQPAIKKDASAQQDS |
| Purity/Format | Affinity purified |
| Blocking Peptide | BARD1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | BARD1 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: BARD1 Antibody [NBP2-47543] - Analysis of human cell line U-2 OS shows positivity in nucleoli, vesicles & nucleus but excluded from the nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/22092_BARD1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-47543-img0001.jpg)
Immunocytochemistry/Immunofluorescence: BARD1 Antibody [NBP2-47543] - Analysis of human cell line U-2 OS shows positivity in nucleoli, vesicles & nucleus but excluded from the nucleoli.
![Immunohistochemistry: BARD1 Antibody [NBP2-47543] - Analysis of human lateral ventricle shows strong nuclear positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/22093_BARD1%2520Antibody-Immunohistochemistry-NBP2-47543-img0002.jpg)
Immunohistochemistry: BARD1 Antibody [NBP2-47543] - Analysis of human lateral ventricle shows strong nuclear positivity in neuronal cells.