HA95/AKAP8L Antibody
| Name | HA95/AKAP8L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-47441 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: FLQEYVTNKTKKTEELRKTVEDLDGLIQQIYRDQDLTQEIAMEHFVKKVEAAHCAACDLFIPMQFGIIQKHLKTMDHNRNRR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | HA95/AKAP8L Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | AKAP8L |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: HA95/AKAP8L Antibody [NBP2-47441] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/15568_HA95-AKAP8L%2520Antibody-Immunohistochemistry-NBP2-47441-img0002.jpg)
Immunohistochemistry: HA95/AKAP8L Antibody [NBP2-47441] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.