KIAA1033 Antibody
| Name | KIAA1033 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-47410 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: SVHTHLKLDDRNPFKVGMKDLALFFSLNPIRFFNRFIDIRAYVTHYLDKTFYNLTTVALHDWATYSEMRNLATQRYGLVMTEAHLPSQTLEQG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | KIAA1033 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | KIAA1033 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: KIAA1033 Antibody [NBP2-47410] - Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6738_KIAA1033%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-47410-img0004.jpg)
Immunocytochemistry/Immunofluorescence: KIAA1033 Antibody [NBP2-47410] - Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm.
![Immunohistochemistry-Paraffin: KIAA1033 Antibody [NBP2-47410] - Staining of human placenta shows cytoplasmic and membranous positivity in trophoblastic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6739_KIAA1033-Antibody-Immunohistochemistry-Paraffin-NBP2-47410-img0003.jpg)
Immunohistochemistry-Paraffin: KIAA1033 Antibody [NBP2-47410] - Staining of human placenta shows cytoplasmic and membranous positivity in trophoblastic cells.