OSBP1 Antibody
| Name | OSBP1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-47342 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: SYFSRDVARKVTGEVTDPSGKVHFALLGTWDEKMECFKVQPVIGENGGDARQRGHEAEESRVMLWKRNPLPKNAE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | OSBP1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | OSBP |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: OSBP1 Antibody [NBP2-47342] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & the Golgi apparatus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9062_OSBP1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-47342-img0004.jpg)
Immunocytochemistry/Immunofluorescence: OSBP1 Antibody [NBP2-47342] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & the Golgi apparatus.
![Immunohistochemistry-Paraffin: OSBP1 Antibody [NBP2-47342] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9063_OSBP1-Antibody-Immunohistochemistry-Paraffin-NBP2-47342-img0003.jpg)
Immunohistochemistry-Paraffin: OSBP1 Antibody [NBP2-47342] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.