RBBP6 Antibody
| Name | RBBP6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-47311 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: KATYDTKRPNEETKSVDKNPCKDREKHVLEARNNKESSGNKLLYILNPPETQVEKEQITGQIDKSTVKPKPQLSHSSRLSSDLTRETDEAAFEPD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RBBP6 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | RBBP6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: RBBP6 Antibody [NBP2-47311] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8181_RBBP6%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-47311-img0003.jpg)
Immunocytochemistry/Immunofluorescence: RBBP6 Antibody [NBP2-47311] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles.
![Immunohistochemistry: RBBP6 Antibody [NBP2-47311] - Staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts while additional cytoplasmic staining in Leydig cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8182_RBBP6-Antibody-Immunohistochemistry-NBP2-47311-img0002.jpg)
Immunohistochemistry: RBBP6 Antibody [NBP2-47311] - Staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts while additional cytoplasmic staining in Leydig cells.