TNIP2 Antibody
| Name | TNIP2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-48949 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:MLEQQILAYKDDFMSERADRERAQSRIQELEEKVASLLHQVSWRQDSREPDAGRIHAGSKTAKYLAADALELMVPGGWRP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TNIP2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TNIP2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: TNIP2 Antibody [NBP2-48949] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleus & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7617_TNIP2%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-48949-img0003.jpg)
![Immunohistochemistry-Paraffin: TNIP2 Antibody [NBP2-48949] - Staining of human kidney shows cytoplasmic positivity in renal tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7618_TNIP2-Antibody-Immunohistochemistry-Paraffin-NBP2-48949-img0002.jpg)