SCIMP Antibody
| Name | SCIMP Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-48502 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:RRGKKWEIAKPLKHKQVDEEKMYENVLNESPVQLPPLPPRNWPSLEDSSPQEAPSQPPATYSLVNKVKNKKTVSIPSYIEPEDDYDDVEIPANTE |
| Purity/Format | Affinity purified |
| Blocking Peptide | SCIMP Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SCIMP |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: SCIMP Antibody [NBP2-48502] - Staining of human tonsil shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction center](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/22572_SCIMP%2520Antibody-Immunohistochemistry-NBP2-48502-img0001.jpg)
Immunohistochemistry: SCIMP Antibody [NBP2-48502] - Staining of human tonsil shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction center