Periplakin Antibody
| Name | Periplakin Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-49306 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:AKEERINKLHSEGDQLLAAEHPGRNSIEAHMEAVHADWKEYLNLLICEESHLKYMEDYHQFHEDVKDAQELLRKVDSDLNQKYGPDFKDRYQIELLL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Periplakin Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PPL |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Periplakin Antibody [NBP2-49306] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: Human Tonsil tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7746_Periplakin%2520Antibody-Western%2520Blot-NBP2-49306-img0002.jpg)
Western Blot: Periplakin Antibody [NBP2-49306] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: Human Tonsil tissue
![Immunohistochemistry: Periplakin Antibody [NBP2-49306] - Staining of human nasopharynx shows cytoplasamic positivity in respiratory epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7747_Periplakin-Antibody-Immunohistochemistry-NBP2-49306-img0001.jpg)
Immunohistochemistry: Periplakin Antibody [NBP2-49306] - Staining of human nasopharynx shows cytoplasamic positivity in respiratory epithelial cells.