CTR9 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-49547
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids:YPDDVEAWIELAQILEQTDIQGALSAYGTATRILQEKVQADVPPEILNNVGALHFRLGNLGEAKKYFLASLDRAKAEAEH
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: CTR9 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: CTR9
• Conjugate: Unconjugated

Product images

Western Blot: CTR9 Antibody [NBP2-49547] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: Human Tonsil tissue

Immunocytochemistry/Immunofluorescence: CTR9 Antibody [NBP2-49547] - Staining of human cell line RT4 shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: CTR9 Antibody [NBP2-49547] - Staining of human urinary bladder shows strong nuclear positivity in urothelial cells.